PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG019700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 592aa    MW: 63702.4 Da    PI: 6.7734
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG019700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS412.15e-1262245842374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPi 90 
                           +lLl+cAe v++++l  a+ +L ++ ela+p g+++qR+aayf+eA++arl++s+ +ly+ lp+ + +  + + +++aa+++f+ +sP+
  Pavir.8NG019700.1.p 224 LTLLLQCAESVNADNLDDAHLTLLEIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLPAASPAAARlHGRVAAAFQVFNGISPL 313
                          579************************************************************7666665554889999*********** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          +kfsh+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g+    s e+le+tg+rL++fA++lg+pfef +
  Pavir.8NG019700.1.p 314 VKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGA----SMEALEATGKRLSDFADTLGLPFEFCA 399
                          ***********************************************************....*************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                           va++  ++++e+L v ++Ea+aV++ +  h+l+d +++ ++    +L+l+++l Pkvv++veq+++h s+sFl+rf+ea++yysalfds
  Pavir.8NG019700.1.p 400 -VAEKAGNVDPEKLGVTRREAVAVHWLH--HSLYDVTGNDSN----TLWLIQRLAPKVVTMVEQDLSH-SGSFLARFVEAIHYYSALFDS 481
                          .7*************************9..999988888888....**********************.899****************** PP

                 GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                          l+a+++++s er++vE++ll+rei+nv+a  g +r+ + + +++Wre+l ++GF++++l  +aa+qa+lll +++sdgy++ ee+g+l l
  Pavir.8NG019700.1.p 482 LDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRSASLAGSAAAQASLLLGMFPSDGYTLVEENGALKL 570
                          **********************************999987.************************************************* PP

                 GRAS 361 gWkdrpLvsvSaWr 374
                          gWkd  L+++SaWr
  Pavir.8NG019700.1.p 571 GWKDLCLLTASAWR 584
                          *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.242197564IPR005202Transcription factor GRAS
PfamPF035141.7E-123224584IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
RHSDPPPHAA TSRATSPTSP PPLLVASRIS RRPLACSLPA LPTQLQLPAF QQQHHHHHAH  60
AEVDVPHTPP PAPAEVAAST TAWVDGIIRD IIGSSGGAGV SITQLIHNVR EIIHPCNPGL  120
ASLLELRLRS LLNADPAPPP LPHPPALLHG STPPAAAPTV RPALPPPPPL PVPDKRRHEP  180
QQEEPNPSPQ SPKAPTAEET AAAAKERKEE QRRKQRDEEG LHLLTLLLQC AESVNADNLD  240
DAHLTLLEIA ELATPFGTST QRVAAYFAEA MSARLVSSCL GLYAPLPAAS PAAARLHGRV  300
AAAFQVFNGI SPLVKFSHFT ANQAIQEAFE REERVHIIDL DIMQGLQWPG LFHILASRPG  360
GPPRVRLTGL GASMEALEAT GKRLSDFADT LGLPFEFCAV AEKAGNVDPE KLGVTRREAV  420
AVHWLHHSLY DVTGNDSNTL WLIQRLAPKV VTMVEQDLSH SGSFLARFVE AIHYYSALFD  480
SLDASYGEDS PERHVVEQQL LSREIRNVLA VGGPARTGDV KFGSWREKLA QSGFRSASLA  540
GSAAAQASLL LGMFPSDGYT LVEENGALKL GWKDLCLLTA SAWRPIQTPC R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-532235844375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.86650.0callus| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0636820.0BT063682.1 Zea mays full-length cDNA clone ZM_BFc0094J16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977413.10.0PREDICTED: protein SCARECROW 1-like
SwissprotQ9FUZ70.0SCR_MAIZE; Protein SCARECROW
TrEMBLK7UAQ50.0K7UAQ5_MAIZE; Protein SCARECROW
STRINGGRMZM2G131516_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein